PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10025355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 337aa    MW: 38418.8 Da    PI: 9.2896
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10025355genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vk++G++ W++++++m+  ++R +k+c +rw +yl
      Lus10025355  4 RQRWRAEEDALLRSYVKRYGPREWNLVSQRMNtpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.89e-1259103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
      Lus10025355  59 KGSLTEEEQHLVIKLQEKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.506153IPR017930Myb domain
SMARTSM007178.0E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-21498IPR009057Homeodomain-like
CDDcd001674.73E-8653No hitNo description
Gene3DG3DSA:1.10.10.602.3E-20660IPR009057Homeodomain-like
PfamPF139212.4E-14768No hitNo description
PROSITE profilePS5129422.78154108IPR017930Myb domain
SMARTSM007175.3E-958106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-1561102IPR009057Homeodomain-like
CDDcd001674.27E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MKERQRWRAE EDALLRSYVK RYGPREWNLV SQRMNTPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQHLV IKLQEKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQHRE KKETSKTPLE  120
PIDESKYDRI LETFAEKLVK ERTTPPPPTG FAMAASNGSN YLHTTDHHHL HQPAMLPPWL  180
SSSNGAVRPP PAPSVTLSLS SSTVAAGGAS PSIPWLQPAD LPPPPPLPPP AGFSNESLVV  240
NDLVECCREL DEGHRAWAAH KKEAAWRLRR VELQLESEKS CMMKEKSEEI EAKIRAMREE  300
QKAALDAIEE EYREQLAGLR RDAEAKEQKL ADQCRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-15792789C-Myb DNA-Binding Domain
1msf_C2e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019863.11e-169PREDICTED: transcription factor AS1
RefseqXP_011019861.11e-169PREDICTED: transcription factor AS1
RefseqXP_011019860.11e-169PREDICTED: transcription factor AS1
SwissprotO809311e-148AS1_ARATH; Transcription factor AS1
TrEMBLA0A067KHN51e-163A0A067KHN5_JATCU; MYB family protein
STRINGPOPTR_0006s08610.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-125MYB family protein